PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04014.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 533aa    MW: 56992.2 Da    PI: 10.4501
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04014.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.7e-17256303148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT+eEd+ lv +v+++G+g+W++++   g+ R+ k+c++rw +yl
  Zmw_sc04014.1.g00030.1.am.mk 256 KGPWTPEEDLVLVSYVQEHGPGNWRAVPTNTGLMRCSKSCRLRWTNYL 303
                                   79********************************************97 PP

2Myb_DNA-binding50.35.4e-16309354148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg++T +E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Zmw_sc04014.1.g00030.1.am.mk 309 RGNFTDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 354
                                   89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.2E-24247306IPR009057Homeodomain-like
PROSITE profilePS5129417.846251303IPR017930Myb domain
SuperFamilySSF466891.2E-29253350IPR009057Homeodomain-like
SMARTSM007174.0E-13255305IPR001005SANT/Myb domain
PfamPF002497.4E-16256303IPR001005SANT/Myb domain
CDDcd001674.01E-11258303No hitNo description
PROSITE profilePS5129424.722304358IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.6E-24307358IPR009057Homeodomain-like
SMARTSM007174.3E-16308356IPR001005SANT/Myb domain
PfamPF002491.1E-14309354IPR001005SANT/Myb domain
CDDcd001671.46E-11311354No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MDRIAGSPPP PLLRFVLSVL VSRRSEADFN VKPCRGTTKS DPPQRHGQRN YRCAGSHVVP  60
SGSHPELCGD EGSVGDTPRF PGRTHVGVAS RVHRETSTTT RASSCRRNHL HPCLRSPAGT  120
RFGLFCPHQT GKHRDRRVRT SGRREPVHAP GFSGGTGRSL VGAVLALPLA ASSSFFPPGP  180
TRGQTRWGPR SAAVTHSQVR ATAYITRPCA APTGPRPSLD RASPSLLGPL VSRGVVGWEE  240
RRMGRPPCCQ KGGVKKGPWT PEEDLVLVSY VQEHGPGNWR AVPTNTGLMR CSKSCRLRWT  300
NYLRPGIKRG NFTDQEEKLI VHLQALLGNR WAAIASYLPE RTDNDIKNYW NTHLKKKLGK  360
MSVGGEDEES KLTAPKGQWE RQLQTDIHTA RQALRGALSM DTSSPAPAAK PEAHAPAPVG  420
QATYASSAEN IARLLEGWMR PGAGNGGKTS SGPSGSSPSA VSGEGASAAS QSGAARTPPE  480
GSTGANGKAE DRGAVVTPGP AFSMLENWLL DDGMEHGDVG IMGMPLADPC DFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-252563584105C-Myb DNA-Binding Domain
1mse_C1e-252563584105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574549.11e-129PREDICTED: transcription factor MYB30-like
SwissprotP813921e-101MYB06_ANTMA; Myb-related protein 306
TrEMBLI1I7G11e-129I1I7G1_BRADI; Uncharacterized protein
STRINGBRADI3G37047.11e-129(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296